SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI102753 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI102753
Domain Number - Region: 49-73
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0811
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI102753
Sequence length 265
Comment (Physcomitrella patens)
Sequence
MPTVQPSISLSKKADIEMEEIIREMQDLQIKLAIIEENTSINNSKNVLKQGYIQRCICCD
DASHTRKDCNEFNNRIRQGIICLKDEKIALKDRDDLLQTNFGKGKMRALLEDYLKEHKTA
ARESASYGARVDDDLERSKETSEFWASAVSTMQKGKLPREASLRTAARIGGRTGWEDPVE
SLSVHAYIAKSQHEALMEEKRRGNFDDTKERNSSKRQTRGDKVREAASQELPIKDTSTSL
GEKKKETKDISHQIHHLSCIMCYLA
Download sequence
Identical sequences A9U5N3
3218.JGI102753 XP_001786168.1.60028 jgi|Phypa1_1|102753|fgenesh1_pg.scaffold_750000002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]