SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI140461 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI140461
Domain Number 1 Region: 109-202
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-26
Family B3 DNA binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI140461
Sequence length 202
Comment (Physcomitrella patens)
Sequence
MAVDKKAPALSYEEERKQRVMENKRIMQELGLVDLSNELKKLKKDSAKKPVKRKMLPAVS
YRDQLDLLPGFRARSGTGGERQGLPRRYLSDTVRLATIEMAEEAFKAIKNPGFVKAMLHS
HVSSCFWLGLPHHFCKKHMPYEDERFTLEDEDGKEWECLYLARKTGLSGGWRGFSLDHDL
VDGDCCIFELVRPLRFKIYFFR
Download sequence
Identical sequences A9T564
XP_001773749.1.60028 jgi|Phypa1_1|140461|e_gw1.167.53.1 3218.JGI140461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]