SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI221558 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI221558
Domain Number 1 Region: 247-534
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.6e-68
Family Tandem AAA-ATPase domain 0.0003
Further Details:      
 
Domain Number 2 Region: 574-597
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000733
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI221558
Sequence length 616
Comment (Physcomitrella patens)
Sequence
MAVHEGQLEATEQNGGNQQRGAEEEEEDIEEYVPVKKRRLMAAQQLLNKKAVKGANGANM
TSTLDEQEGLKSSEIKPSLLVKSSQLKKDAPEISVTEALVMQEKEMIERLSEKKHLVPVR
ELAKGISYTEPMQTGWKPPLAIRNLSEKDCKDIRRQWHILVEGDEIPPPIKNFKDMRFPD
PILKKLKAKGITRPTPIQVQGLPVILSGRDMIGIAFTGSGKTLVFVLPLIMLALQEEVRM
PLIGGEGPFGLVVCPSRELARQTYDVVEEFTAVLSEKGYPQLRSMLCIGGIDMRSQLEVV
KHGVHIVVATPGRLKDMLAKKKMNLDNCKYLTLDEADRLVDLGFEEDIREVFDHFRGQRQ
TLLFSATMPKKIQNFAKSALVKPVVVNVGRAGAANLDVIQEVEYVKQEAKIVYLLECLQK
TPPPVLIFCENKADVDDIHEYLLLKGVEAVAIHGGKDQEEREFAIASFKAGKKDVLVATD
VASKGLDFPDIQHVINYDMPAEIENYVHRIGRTGRCGKTGIATSFINKNQSETILLDLKH
LLKEAKQRIPPVLATLDDPMEEAEELAKASGVKGCAYCGGLGHRISECPKLEHQKSQAIA
GTRRDYFGSGGYGGEI
Download sequence
Identical sequences A9TEN1
3218.JGI221558 PP1S215_4V6.1 jgi|Phypa1_1|221558|estExt_Genewise1.C_2150004 XP_001777066.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]