SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI227676 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI227676
Domain Number 1 Region: 132-229
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-23
Family B3 DNA binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI227676
Sequence length 229
Comment (Physcomitrella patens)
Sequence
MAVVVSGQLVPYEETRKRRVEENKRRMEELGLFDFSNSFVKNQPMRRKSVRRKTLSPEEV
ATEARRSPRFAGKPVVEHEDVEIHKQRRGLSRSGLHARCGTVYRQLAGRRDVPESTRQAA
LDAAEVVYKALKNPGFVRGMLHSHTASGFWLGLPVSFCREYLPHRDETIVLEDEKLLEWE
CVYLAKKIGLSGGWRGFSIDHSLVDGDACVFELVEPKRFKIHIFRCDNC
Download sequence
Identical sequences A9U2C0
jgi|Phypa1_1|227676|estExt_Genewise1.C_4340016 3218.JGI227676 XP_001785010.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]