SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI47563 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI47563
Domain Number 1 Region: 115-210
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.37e-25
Family B3 DNA binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI47563
Sequence length 214
Comment (Physcomitrella patens)
Sequence
GDEMAAMSYEEARKQRMDENKRRMEELGLVDLSKNLKQLKPKIPAKKPEKRKIDSQEARR
SSRVASKPVVSYKEQLDRVRGIRETRVKKSSSRRKLTESARMATIEAANEVIKGIEYPAF
VKPMQHSNTSNSFWLGIPADFCKERMPLADEKFILEDENGKEWECLYLAHKEGITGGWRK
FLLDNELEDGDCCIFELKSPLRFKVHVLKWDEED
Download sequence
Identical sequences A9T430
jgi|Phypa1_1|47563|gw1.162.133.1 3218.JGI47563 XP_001773364.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]