SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI81181 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI81181
Domain Number - Region: 25-61
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0152
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI81181
Sequence length 289
Comment (Physcomitrella patens)
Sequence
MAINMVKNKEKTQKPTNIRTNVWYSNCKDHDHLVTECPSPSQMMDQCTFCGGKHLTANCW
NLHRCQFETYYYSFEFKRSLTEAFGDRKIEQRPGNQMAPNELIREFKTKFGQLPWQERQL
LETKKIGLFLQAADKHLEDKLFFHLADKTTESGFTNNWKLVKEIVGLLAKQQKIKAHGII
SRLEPVLTSQNLEPPQKRIKTVKNYTLEELIKGIRDLKVEMTELKKSQMISLSRIVEGSK
EFVERCMCERDIVILPSWLESSSFSIQLTAEALPINQATTTTNYNPKLT
Download sequence
Identical sequences A9SLY4
3218.JGI81181 XP_001767338.1.60028 jgi|Phypa1_1|81181|fgenesh1_pg.scaffold_92000061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]