SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI81511 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI81511
Domain Number - Region: 258-294
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00115
Family Retrovirus zinc finger-like domains 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI81511
Sequence length 324
Comment (Physcomitrella patens)
Sequence
MVIMNENLTSKRIKQSKERTERSQARNLLRNESDHKLKKKHRQSWIKSWLHACRYIRSYP
EDDRLLIFQKYIPLKKLPRALAGSAANSPADFSKSLTENEEGKEELGTPLGIFSIGNTSD
PNKTGSEDQHKLLANKDQFRVYQNLSFSPHIQLFKWVQWAIERLASCYYLLFGICQEIVD
AIPLQAVPPSSSHSYARYSAYQKPIPTKELPNALLSRDPNESLLLTLTKKMDELVVNLVK
DKEKRHKPTNMHPNVWYSNCKGQGHLVTECPSPPQMTVQCTFCGGKHITTNCWNLRKQQQ
LSNQIMTQPTSWNVNQVQMNNRFG
Download sequence
Identical sequences A9SMT5
XP_001767663.1.60028 jgi|Phypa1_1|81511|fgenesh1_pg.scaffold_96000016 3218.JGI81511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]