SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI82504 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI82504
Domain Number - Region: 369-411
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000144
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI82504
Sequence length 922
Comment (Physcomitrella patens)
Sequence
MGVSRKRRTNSHDGFEEPIGSNFDNPIRAVMFSVPFQGTLFSVNGFLKGKNGGESLAARA
NFGSKLESFIFQQSKTDRLLDYRQISILPSTARRPARSRAGKHSYVPLEKLPRTLVGNFV
NIPVEILRPLSEREGGIGVFGTPLGNFPIGGIAETSNRGSTDWHELVANKGNYIVFQNPT
SSPTSQPTKLFAENNSKARTAESSIIRVRESRDYFKTNFRGTKNSMAAGGPAVPIAVQMG
TLGDPTTSSAPLPTFRGLPGADPDQHLSQFLTACVANNGRTEDIWSDYGTIPQGIVNAVP
LQAVLPSSSQPYVPYSAYQKSIPSKELTNELVSRDPNESLLLTLTKKIDELAVNLAKDKE
KRHKPINMRPNVWCSNCKGQGHLVTECSSPPQMMVLCTFCGGKHTTANCWNLRKQQQVGQ
QTMSQSTSWDVNQMQTSQPAEDKGLVQRDLAVHRVEVVNAVLIRGQQKGKNRIQDLDDPI
EVTTVAPSMRRTKPIPILDRIPILGPQQDEEPNSVSRANFSGTSRSIPNDPVPIPAQPNI
SLYLLKEPLVSFIMSREKVKRASEKEEEGRRVRSRSNMDELSLCILTNMEPMRLEICWNA
TWQKDFRSVQLYPFLRAADNLPSIDIKLLEEYLTNYDPEDGSSVVKGRTLGIDENILHKA
LQLSIVELAVGTEESSDFNPGSYFKGGMTSLERNQGWRTADALTPELMEWMRFIQKRLGL
NRHMTYMAKRLLYATIGSFEGMVFNWTTYVATRIHAELSYKRRSVRIATLLCSNYIQSAI
VYELSQPLPEKGKTIAAPILPKPRSNLFALPWGPGETSQQAREPISVRERDPMVQRDNRP
VDIQHQTPEENSVKERFLVQLSQLQQTANELVDHTNFKQQLVACKREMAEQRQKLLEQDW
VNRATKEANSRLKHALGIKQQA
Download sequence
Identical sequences A9SQD2
XP_001768629.1.60028 jgi|Phypa1_1|82504|fgenesh1_pg.scaffold_104000003 3218.JGI82504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]