SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI82862 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI82862
Domain Number - Region: 208-240
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.068
Family Retrovirus zinc finger-like domains 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI82862
Sequence length 506
Comment (Physcomitrella patens)
Sequence
MEGGNLDSASSGVGRRASFGGQSMHFDPNSTSMFEALTLFMQQQEQQVKDRKESMANKAL
QAVVDKIDQFEGKDITKYLRCYVKEMELKHISKSKMVQLFELASAREIRNQVKFLIQHFG
GSWEKFSQALKDEFFLEDSDRVTKRPLQPSKIKVSSIYPTSLIQPSMATSKKEETRINEI
IRGMRDLQIKFAKLEEKGQSSRTSTKQRPRPMEGVVHRCMWCDSIDHSRRECEEFIEALR
KGVVFFKDGMIHSKENGEKLETNFGKRGMKLFIGDTFKVQTISSNEASTYWVEADPSRCL
SINLEFSIESSSLWTSTLRALKKNYKGKRARQQKNSIHEETMESISIKEREMGKEKAKVP
TYKLQTNIEAATDLKKELYNKKKWPIDTEHGWMIRATNNSKGDLYGACPNIKVTIGDVIH
EQNFFVQDRSTYPIILGQPYIISTRMETKVMDDGSAYVRIRSQDGMKAVQFLTVSANHER
NRDKLREKSISNKKFEDLEDFYHTPL
Download sequence
Identical sequences A9SRG5
XP_001768880.1.60028 3218.JGI82862 jgi|Phypa1_1|82862|fgenesh1_pg.scaffold_107000024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]