SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI87432 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI87432
Domain Number - Region: 251-290
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00994
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI87432
Sequence length 562
Comment (Physcomitrella patens)
Sequence
MDPSIASMFQAFSLSMQQLQSNDRKEALATKALQAVVNKIDQFDGKNISRYLRCYVREME
LNRVSEKKMVALFGLATIPEIRDHITSITDRCGNSWEDFSHALKDEYFLEDADRVTKKLF
LGWIERPNKNLQATELLLQAADGELQDKLKPLLEDKEEDEGLTTKWKNVEDAVGLLTKKE
RRKDRSNIPKTVQAPKAAVRTTTPTMLTVQPSTSLSKKANMGMEEIIRGMRDLQIKLARL
EENTSINNLKNVSKQGYVQRCIWCNDASHTRKDCNEFNNMIRQGIICWKDGKIALKDRED
LLQTNFGKGGMRALVQDYLKEHETVVRESASYGARVDDEIGGSMETSEFWASAVSTMQEG
KLPREALLTTTATIRGRIGCEDPVESLSVHAYIAKSQHEALMEEKRRGNFDDTREGNSFK
RQTQGDKAREAASQELPVKDTSISLGEKTTETKDKGKSIAYKLLSDIEAATNLKGVLEER
ILNAKVEFTLKEVLGIVKKEFHDVIIDSIKRKRDEEEVDIGYKQPTNEKNGYNQRVHCRI
TCFPAQKCAGRLAVECSIEIPR
Download sequence
Identical sequences A9T325
3218.JGI87432 XP_001773014.1.60028 jgi|Phypa1_1|87432|fgenesh1_pg.scaffold_157000069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]