SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI89433 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI89433
Domain Number - Region: 46-85
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0133
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI89433
Sequence length 510
Comment (Physcomitrella patens)
Sequence
MPTVQPSTSLSKKTDMGMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCD
DASHTRKDCNEFNNMIRQGIICWKDGKIALKDREDLLQTNFGKGGMRALVQDYLKGHETV
ARESASYGARVDDEIGGSTETSEFWASAVSTMQEGKLPREALLRTAATIRGRTGWEDPVE
SLSVHAYIAKSQHAALMEEKRRRNFDDTREGNSFKRQTRGDKAREAASQELPVKDTSASL
GEKATETKDKGKSIAYKLLSDIEAATNLKGVLEERILNAKVEFTLKEVLGIAKKEFHDVI
IDSIKRKRQLMRETGMSHAIDARICRDEEEVDISYKQPTNEKNGYNQRVRFEDSSDKEME
TLSHYTQKHWARATTEVLVKVGDIEEPIVALVDHDSEINLMSKDLYKKQKWPIDMEHGWA
IRAANNTRGELYGACSDVKIWIGDVATEQHFFVQDTTSYPLILGQPYITATRMETKVLDD
GSAYARQEDESDMDNEGDEDELDKDVGDIF
Download sequence
Identical sequences A9T8D7
XP_001774901.1.60028 jgi|Phypa1_1|89433|fgenesh1_pg.scaffold_183000021 3218.JGI89433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]