SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI91080 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI91080
Domain Number 1 Region: 140-173
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000811
Family Retrovirus zinc finger-like domains 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI91080
Sequence length 328
Comment (Physcomitrella patens)
Sequence
MFVKEAQSITVSASLDRAKVWEECHYDQFLTTSATMIPVQSNYQYPALNGSVGSYPQMIK
TVAHSSANTQGSVNVIPLQALPPQVTTAYAPYFPYQTQESTLVEKQIIPASKDSNEALLL
NLMKKMEEMAINMVKDKEKRQKPTNTRTNVWCSNCQGHDHFVTECPSPSQVLGKIEGINR
GPQDSPVNRVECVHTVLTRSQQKGKGQSHPITDPSHSGPDTGKVLSLDLVVKPNEVPITE
SSVPSGVDLLPLQFQEASYPLKDPLGKGSPKEAQAAVSIPSLILDKRTRIGFSKLDPIGS
SNPSCELALLFLLTPVIGIEQSISVCPG
Download sequence
Identical sequences A9TCT1
jgi|Phypa1_1|91080|fgenesh1_pg.scaffold_205000040 3218.JGI91080 XP_001776395.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]