SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 323097.Nham_1108 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323097.Nham_1108
Domain Number 1 Region: 461-563
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.16e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 323097.Nham_1108
Sequence length 583
Comment (Nitrobacter hamburgensis X14)
Sequence
MSIADGRPHQIRKPTFAELFTPKLVTVLREGYRGADFRADVVAGLTVAIVALPLSMAIAI
ASGATPDRGLTTAIIGGFFVSLLGGSRFQVGGPAGAFIVLVALTVERHGIDGVILATAMA
GVLLIAAGLLRLGTYIKFIPYPVTVGFTAGIAVIIFASQIKDFLGITLAKEPSQLVPKLE
ALARAGDTVSMSAVAVSVIAVVIIAGLKRFRPAWPGMLIAIVVTAVAAWALSLPVETIGT
RFGGIPRELSWPAWPAFSLDKVQAVFPDAVAFALLASIESLLSAVVADGMTGRRHRSNCE
LMAQGVANVASALFGGLCVTGLIARTATNIRAGARGPVAGMLHSAFLLLFMLIAAPLASY
IPLAALAAVLAVVAWNMVEKHEFATLIRASRGDAVVLLATFLLTVFRGLTEGILVGFALG
AVLFIHRMAQITGIEANVPLAAEDRADDANGDRQPYDAAMVSDPDVVIYRITGAFFFGAA
SEVGSVLDAIMERQKAFVVDFAAVPFLDSTAANAISRVAAKARRQGVSFFITGASPVVRR
ALLTHGVRPPRATFRETIARAVADIKAARHAPPIAAIDAQPAP
Download sequence
Identical sequences Q1QP92
gi|92116686|ref|YP_576415.1| WP_011509650.1.12189 323097.Nham_1108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]