SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 323098.Nwi_1068 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323098.Nwi_1068
Domain Number 1 Region: 9-189
Classification Level Classification E-value
Superfamily SIS domain 8.29e-49
Family mono-SIS domain 0.0000083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 323098.Nwi_1068
Sequence length 197
Comment (Nitrobacter winogradskyi Nb-255)
Sequence
MSQNPIAVHFQQSLAALQRAANDTTLLAAASEIAVTIIDALRSGNKVLLIGNGGSAADAQ
HIASEIVGRYRKERPGYAAIALTTDTSALTAISNDYGFERIFCRQIESLGRPGDILLALS
TSGRSPNILTALDAARRLGLVTAGFTGLKGQSLREVCDHLLVAPSDDTPVIQQIHMTAAH
AICDTVEHALADGDSDR
Download sequence
Identical sequences Q3STR1
WP_011314364.1.37845 323098.Nwi_1068 gi|75675261|ref|YP_317682.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]