SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 323259.Mhun_1791 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323259.Mhun_1791
Domain Number 1 Region: 1-256
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.13e-85
Family Tryptophan biosynthesis enzymes 0.0000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 323259.Mhun_1791
Sequence length 259
Comment (Methanospirillum hungatei JF-1)
Sequence
MNRLKEAFETRTKSLLMTFTVAGDPDFETSLEIIKALENGGADIIELGLPFSDPVADGPV
IQQADQRALASGMNTDRFFDLVREVRKSSDIPLVVLTYTNLILQRDINTFYQDAADAGID
AVVVADLPYEEAGPYITAAETAGVAPVMMVSTTTSPERLSKILTVKSGFIYLVAALGVTG
MRQKTDPVAQKLLADLKNRTDIPIAPGFGISDREQVREWTDAGADAVIVGSALVREIEDS
LVKPDTLIPRITAFVQSLK
Download sequence
Identical sequences Q2FKX6
gi|88603053|ref|YP_503231.1| 323259.Mhun_1791 WP_011448776.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]