SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323259.Mhun_2391 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323259.Mhun_2391
Domain Number 1 Region: 70-210
Classification Level Classification E-value
Superfamily TPR-like 5.55e-22
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 323259.Mhun_2391
Sequence length 211
Comment (Methanospirillum hungatei JF-1)
Sequence
MIRKVLYISLILTGLLIPAGVLAADDGWSHGSLFSAPNWLLEQFDDESREMSKMDYFGTK
LVEPTPTQPTAMDLVKEGWAYLEGGNYKDALKSFEKALEINGTSTEAWYGRGLALENQKR
YLSAIDAYTKAVSYSKKPASSWGPNAGKGRSYLALNQYENAKDALTVAISQYEQSGENMP
DELASMYRDLAQALEMLGETDAAQEALEKAG
Download sequence
Identical sequences Q2FRV2
gi|88603634|ref|YP_503812.1| 323259.Mhun_2391 WP_011449351.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]