SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 323259.Mhun_2753 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323259.Mhun_2753
Domain Number 1 Region: 6-160
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.31e-21
Family N-acetyl transferase, NAT 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 323259.Mhun_2753
Sequence length 174
Comment (Methanospirillum hungatei JF-1)
Sequence
MIAHELSSHRLSLVPVTVASCTAELKENYGLSLLLDADVPGDWPPPLVTKETLHEFIGML
TDPSSCRLCAWYWILKSDGRSSRPVLIGSGGLYINEDGTCEIGYSVLEAFQCRGYATEAV
GTILDFVFSQGDFGTVYATTYPHLYPSVRVLQKNGFIPDGPGKEEGTVRFYIRK
Download sequence
Identical sequences Q2FTQ1
323259.Mhun_2753 gi|88603989|ref|YP_504167.1| WP_011449704.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]