SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323848.Nmul_A0232 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323848.Nmul_A0232
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.79e-31
Family Sfri0576-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 323848.Nmul_A0232
Sequence length 114
Comment (Nitrosospira multiformis ATCC 25196)
Sequence
MITIEETENLISIAVFGEFTLADYQEFEDKVLRKAGREGKVNVLFDWRDMLSYTIDVAWE
DIKFVREHGSEFNRIAIITENQWRAWAAWVSNLFVDADIRVFRDYAAAKTWLEG
Download sequence
Identical sequences A0A1H3VU68 Q2YCI1
372708 gi|82701366|ref|YP_410932.1| 323848.Nmul_A0232 WP_011379594.1.10075 WP_011379594.1.92891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]