SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 323848.Nmul_A1039 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323848.Nmul_A1039
Domain Number 1 Region: 24-217
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.44e-26
Family Clp protease, ClpP subunit 0.038
Further Details:      
 
Domain Number 2 Region: 389-452
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000248
Family NfeD domain-like 0.0037
Further Details:      
 
Weak hits

Sequence:  323848.Nmul_A1039
Domain Number - Region: 205-270
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0889
Family MgtE N-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 323848.Nmul_A1039
Sequence length 456
Comment (Nitrosospira multiformis ATCC 25196)
Sequence
MKLLIRTLFVSVLAMLFLLPSIVRASPVVVLKIDGPIAPASADFIQRGLERAANENALLV
VLQLDTPGGLDTSMRQIIRGVLASPLPVATFVAPSGARAASAGTYILYASHIAAMAPGTN
LGAATPIEMGGFPRSEPEPRPQPKSGENRAQNPEKEGQLPVKDEMSRKMIHDAAAYIRGL
AQMRGRNVEWAERAVREAVSLSASEALHLKVVDYIATDIADLLKQLNGRQVNVLGQDRKL
DTTSATMEVVEPDWRTRLLAIITNPSVAYVLMLIGIYGLFFEFANPGFVLPGVAGAICLL
IALYAFQLLPVSYAGLALILLGIGFMVAEVFLPSFGALGIGGIIAFVVGSLMLIDSEAPG
FGIPWTLVGGVAFASALFLISVIGMALKTRRKPLLSGQEHMVGSVGEMLEDTSGDGMARI
RGELWTVHSAQPLVRGQKVRVTGIDGLILHVTAAEK
Download sequence
Identical sequences Q2YA79
323848.Nmul_A1039 WP_011380387.1.10075 gi|82702168|ref|YP_411734.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]