SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 323850.Shew_0522 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323850.Shew_0522
Domain Number 1 Region: 22-294
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.43e-93
Family Methylenetetrahydrofolate reductase 0.00000000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 323850.Shew_0522
Sequence length 296
Comment (Shewanella loihica PV-4)
Sequence
MAFHHAQHANSLNQSLSELNGDINVSFEFFPPATPEMETILWNSIRRLEPLKPKFVSVTY
GANSGVRDRTHGVIERIQKETDLVAAPHLTLVDASDEELVELAKHYWNSGIRDIVALRGD
LPAGSPKPTRFANDLVRLLKSVADFDISVAAYPEVHPDAPNAQADLINLKKKIDAGANRA
ITQFFFDVESYLRFRDRCVAAGIDVEIVPGILPVTNFTQLKRFAGMTNVSIPSWLHKQFE
GLDDDPSTRQMVGANVAIDMVKVLSREGVKDFHFYTLNRAELTYAICHTLGVRPGK
Download sequence
Identical sequences A3QA96
gi|127511456|ref|YP_001092653.1| WP_011864328.1.33760 323850.Shew_0522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]