SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 323850.Shew_0615 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323850.Shew_0615
Domain Number 1 Region: 557-1039
Classification Level Classification E-value
Superfamily ALDH-like 1.96e-130
Family ALDH-like 0.000000296
Further Details:      
 
Domain Number 2 Region: 192-536
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.02e-109
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000396
Further Details:      
 
Domain Number 3 Region: 18-191
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 3.92e-64
Family N-terminal domain of bifunctional PutA protein 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 323850.Shew_0615
Sequence length 1059
Comment (Shewanella loihica PV-4)
Sequence
MFKASEVLTGRYDSATLDELFTAITNNYIVDEEQYLSELIKLVPSSDDEIQRITKRAHDL
VHKVRQYDKKGLMVGIDAFLQQYSLETQEGIILMCLAEALLRIPDAATADALIDDKLSGA
KWDEHLSKSDSTLVNASTWGLMLTGKIISLDKSIDGKPSSLLNRLVNRLGEPVIRQAMLA
AMKIMGKQFVLGRTVQEALKNSTDKRKLGYTHSYDMLGEAALTMKDAQKYYQDYSNAIAA
LGAQQYDESEAPRPTISIKLSALHPRYEVANEDRTMTELYDTLIKLVSQARSLNVGVSID
AEEVDRLELSLKLFQKLYNSDAAKGWGLLGLVVQAYSKRALPVLCWITRLAKDQGDEIPV
RLVKGAYWDSELKWAQVAGEGGYPLFTRKAGTDVSYLACARYLLSDATRGAIYPQFASHN
AQTVAAITDMAGDRLYEFQRLHGMGEELYDTLLAESGVSTVRIYAPVGAHKDLLPYLVRR
LLENGANTSFVHKLVDPKTPIESLVVHPLTTLQSYKTLANNKIVQPIDIFGAERKNSKGI
NMNIISESEPFFAALDKFKDQQWSAGPIVNGETLSGETIEVKSPYDTTQIVGKVAFANNQ
AIEQALASAHNAFGSWCSTPVEVRANALQKLADLLEENREELIALCTREAGKSIQDGIDE
VREAVDFCRYYAVQAKKMMGKPELLPGPTGELNELFLQGRGVFVCISPWNFPLAIFLGQV
TAALAAGNTVVAKPAEQTSIVGYRAVQLAHEAGIPKEALQFLPGTGATVGATITADERIG
GVCFTGSTVTAKRINLTLAQRDGAIIPLIAETGGQNAMVVDSTSQPEQVVNDVVSSSFTS
AGQRCSALRVLYLQEDIADRVIDVMKGAMDELTIGNPGSVKTDVGPVIDATAKANLNAHI
DHIKQVGRLINQLELPAGTENGHFVAPTAVEIDSIKVLEKEHFGPILHVIRYKAADLPKV
IDDINSTGFGLTLGIHSRNEGHALEVADKVNVGNVYINRNQIGAVVGVQPFGGQGLSGTG
PKAGGPHYLTRFVTEKTRTNNITAIGGNATLLSLGDSEE
Download sequence
Identical sequences A3QAI9
323850.Shew_0615 gi|127511549|ref|YP_001092746.1| WP_011864421.1.33760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]