SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 323850.Shew_3388 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  323850.Shew_3388
Domain Number - Region: 92-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000209
Family NfeD domain-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 323850.Shew_3388
Sequence length 153
Comment (Shewanella loihica PV-4)
Sequence
MEFSNPIFIWIAVGLVLMLAEIILPGGIVIFLGAACVVVAGALTLGWVEGFVQALTLWFI
AAIVLLLAFRQLTQRLVGGDSHVDNTDEEFDLYNQVAVVKAVIGPAQQQGRVEFQGSEWP
ALGDGSEIPIGARVRVICRENIALVVEPLTEQA
Download sequence
Identical sequences A3QIF6
gi|127514316|ref|YP_001095513.1| 323850.Shew_3388 WP_011867184.1.33760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]