SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 324057.Pjdr2_1384 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324057.Pjdr2_1384
Domain Number 1 Region: 209-402
Classification Level Classification E-value
Superfamily PheT/TilS domain 4.71e-73
Family B3/B4 domain of PheRS, PheT 0.0000028
Further Details:      
 
Domain Number 2 Region: 37-199
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.67e-49
Family Myf domain 0.003
Further Details:      
 
Domain Number 3 Region: 477-707
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.48e-48
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00021
Further Details:      
 
Domain Number 4 Region: 717-814
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.45e-30
Family Anticodon-binding domain of PheRS 0.00048
Further Details:      
 
Domain Number 5 Region: 411-485
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 4.49e-17
Family Domains B1 and B5 of PheRS-beta, PheT 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 324057.Pjdr2_1384
Sequence length 815
Comment (Paenibacillus JDR 2)
Sequence
MKVSYQWLNKYIDLTGYTAEELAEKMTRGGIEIDSVESLNKGVSGVVVGYVKSREKHPDA
DKLSVCKIDVGTGEELQIVCGAKNVDAGQKVPVAMIGAKLPGDFAIKRAKLRGVESQGMI
CSAKELGINDKLLPKEQQEGILVLPESTPVGTPIGEVLGINDEVLELDLTPNRSDCLSML
GVAHEIGALTGREVRIPEPAVNHAADRADSHIAVSISAPEQCSHYSARYIKGVKIGPSPQ
WLQNRLIAAGVRPISNVVDVTNFVMLEYGQPLHAFDADAITTGRIDVRLAKQGEKIVTLD
DQERTLEPQMLVITDGEKPVALAGVMGGASSEVNDKTVNILLESAKFDGGTVRKTSRQLG
LRSESSIRFEKEVDPARVIPALNRAAALIAELADGLVAEGIVEAVVTKTEPAVVEVTLDK
INGYLGTELSRLEVQTIFDRLHFSYRLSDANDQFAVTVPTRRGDITRDVDLIEEVARLFG
YDNIPTTPIHGDVTPGGLTKPQTIRRELRRRLTDAGLYEVISYSFTGPSRTELFPELTGK
DLKAVKLAMPMSEDRSVLRTTLIAQLIETATYNRNRKNESSAIFEIGSVFHTEEEQLTRL
PEEKQRLAVLLTGNRVDAQWNRKAEPVDFYDAKGVLETVIDVLGLTSKVRYESAQPANFH
PGRTAAVIVDTAHGPETIGYVGQLHPTLQHESDLADTYVVEVELGTLYGLADTAIEYKVL
PRYPAMQRDIAVVLEQAVPAAKLTAIAWAVAGELLESVRVFDVFTGEKLGAGKKSVALSL
VYRHADRTLTDEEVTELHGKVVAELEQSFAAELRK
Download sequence
Identical sequences C6CWJ5
324057.Pjdr2_1384 gi|251795415|ref|YP_003010146.1| WP_015843006.1.29859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]