SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 324602.Caur_2245 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324602.Caur_2245
Domain Number 1 Region: 1-180,226-299
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.27e-28
Family ABC transporter ATPase domain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 771-1015
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.68e-16
Family ABC transporter ATPase domain-like 0.0078
Further Details:      
 
Domain Number 3 Region: 486-569
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.00000000000000798
Family Rad50 coiled-coil Zn hook 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 324602.Caur_2245
Sequence length 1032
Comment (Chloroflexus aurantiacus J 10 fl)
Sequence
MIPLQLALRNFMCYRATENGDPLRLDLDGLHVLCLSGENGAGKSTLLDAITWALWGEARR
PDDDLITQGETEMMVELVFALDGRKYRVIRQRQRGRSSGRGTGAGKTWLDLQQFDGTTWR
PIGENTIRETQRKITELLRMSYTTFVNASFLLQGRADEFTSKTPAERKEVLAEILDLAEY
AELERRARERVRLLEADLIRVRGQLETLQPIANQVPFWQQAVAEAEQRQHTLQQQRTALE
AEFTQASEKLRHLEQEAHRQREVQNRIAILTGEIQRYSNELRELNARIAQAEQTIAQRPL
IEAGLAELHAARADLERLEQLRTRYDELMARKRELQQELKAELNLLNERLSHAIQQLDRL
YAEAQRLVGLQQRVAAIRQRLRELAPVHERLVQCQHQRTALEQHLNHIRDLVMRQRLLQN
QLEQQRNTLQSELNRSHQELARLDRQLSDVETWRNALRAAQDAQARVQILEAEQLNRRQQ
EQVVLDRLSAARAEAAQARRDIETLQTNQALLATGKGECPVCRRHLAANEADHVYAHYRQ
ELERLQAQETQAKAAIQAAEQELKQIRSTLTSTEQELTRLRQQAATIESLHHQLNQAATW
QTERDQLAQRIATLTGQLTTGSINPAVQAELDTLITDLEAAGDIESVQRDLRMLNDEMMT
LEQQLREHSRLEGELSTCQNDIERIEHALRDLPAAEATVAELQRQIAENDFGHEIRVAGR
QVVAELESLNYRPEDLEATRALVRSLTRWEQAERDLLLAEQRYATDLKLREQTQQLCDHA
ERERQTLHAEAEALAHQLRVLPTVQATVNQVKQQLSANEQALQAAGRDLAEKQAYYRQAE
SAAAEVESLQTQERQLSERTALFAELAEAFGKKGVQAMLIETAIPQLEDEANRLLARLTD
GQMHLRFEMQRDTKKGDTVETLEVRIADALGTRDYAAFSGGEAMRVNFAIRMALSRLLAH
RAGARLETLVIDEGFGVLDADGRERMVEAITAVQRDFARIIVITHIDDLKDRFPATLEIR
KTPLGSRWELRG
Download sequence
Identical sequences A9WFV4
WP_012258108.1.35445 YP_001635843.1.55443 gi|222525668|ref|YP_002570139.1| 324602.Caur_2245 480224.Chy400_2419 gi|163847799|ref|YP_001635843.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]