SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 326297.Sama_2014 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326297.Sama_2014
Domain Number 1 Region: 453-540
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000314
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 326297.Sama_2014
Sequence length 592
Comment (Shewanella amazonensis SB2B)
Sequence
MDESKGVCVSRLLSLMPGLASFKDYRKEWFKDDVRAAFSVSAVALPVAIAYAQLTGVNAL
VGLYSCVLPMMVYALFGTSRQLIVGPDAATCAVVAAVVTPLAAGDSIKHWQLAMTMTAMT
GFWCLIASRFKLGVLADFLSKPILMGLLNGVAITIIVGQASKILGFSFDERYLLDRIAAA
PGYLSQIHWATLAMSLGAVLIFLLVKRFRPTWPAAMLVIVVSTLVAWAANLEQFDVALVG
DVSINMPAFQMPAFDIGIARELVMPALNLAMVSFVSMMLTARSFAAKNGYDIDPDKEFRA
LGIANIASALSQGFAVSGADSRTAVNDASGGKTQLVSLIAALIIGIIAWLFTAPLAFIPS
AALGVVLVVASWSLLDLKTLWKLRKRDQRAFLLAMTTFVAVLLIGVIPGITLAVLLGLFQ
FLQVVMRPSDQCLGLDAKGTLRSLDGSDKAVAVPGVFIYRFNSPLTYFNASYFKRRLLER
IAAEPETPECVIIDAVPCFTHPDISVMAMLSDLYALLKRRHIRLILAGRKRQLLSWCEAQ
GIPTGEGGLLIRSDLYLALKMNQAYKQALADGQAPVLKRPVDLDLVLEHSHL
Download sequence
Identical sequences A1S763
gi|119775149|ref|YP_927889.1| 326297.Sama_2014 WP_011760127.1.25267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]