SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 326427.Cagg_2069 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326427.Cagg_2069
Domain Number 1 Region: 393-492
Classification Level Classification E-value
Superfamily SpoIIaa-like 9.03e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0034
Further Details:      
 
Domain Number 2 Region: 283-374
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.94e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0017
Further Details:      
 
Weak hits

Sequence:  326427.Cagg_2069
Domain Number - Region: 95-336
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.021
Family Peptidoglycan biosynthesis glycosyltransferase MurG 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 326427.Cagg_2069
Sequence length 505
Comment (Chloroflexus aggregans DSM 9485)
Sequence
MRKLLVILGVPIDNLTMAEALDRCDEFIAVGRATGRLHQIATVNADFVVNALHDPELRRI
LQEADMATADGMPLVWASRLLGGPLPGRVTGADMVPALAERAAQRGYSIFFLGAREGVAA
KAAAILQERYPGLRVAGVLSPPPSSVLEMDRSVVEAVKAAQPDILLVAFGNPKQEKWIRM
YAHELRVPIAIGVGGTFDMIVGVTKRVPLWMQRSGLEWVYRLIQEPRRLWKRYVHDFVYF
GYFFARQWWAMQRGRALSIVPVASPSASEQPPAPPTPTVPWPVLTVGVRLEAGNLEPFNQ
TAYQLLETSPYLILDLSVTQFLDSSALGALVALAKRARTQGGDLLLLNVQEPILRILDLL
RLNRFFEQFPDLPSIEAWIAQQQQPAPTVPASDHGWAIIPAPRLFDATTAPTVLEQVSAA
LNKAARVVIDCSGTTFMASAGMATLVKLDRLAREQGGALRIAGCSPDVLRTLQLVKLDLV
LAIFPDVRAATTAPVGNSHVAAEGA
Download sequence
Identical sequences B8GBZ0
326427.Cagg_2069 gi|219848960|ref|YP_002463393.1| WP_015940815.1.86148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]