SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 329726.AM1_2512 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  329726.AM1_2512
Domain Number 1 Region: 4-234
Classification Level Classification E-value
Superfamily PHP domain-like 5.49e-34
Family PHP domain 0.011
Further Details:      
 
Domain Number 2 Region: 756-840
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 4.32e-16
Family Intein (protein splicing domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 329726.AM1_2512
Sequence length 864
Comment (Acaryochloris marina MBIC11017)
Sequence
MSFVGLHIHSDYSLLDGASQLPDLVSRAVELNMPAIALTDHGVMYGAIGLIKTCKKQGIK
PIVGNEMYVINGDITKQERRPRYHQVVLAKNKKGYQNLVKLTTISSLHGVQGRGIFSRPC
INKDLLEEHHEGLIVTSACLGGEIPQAIMKEKPDIARRIAKWYKELFGDDYYLEIQDHGS
QEDRVVNVELVRIAQELDIKVIATNDSHFISCYDVESHDALLCIQTGKLITEDKRLRYSG
TEYLKTADEMALMFRDHLTDDVIADAIATTLEVAEKIEAYDIFRDPQSPDYEVPDGYTAE
TYLEEVTWDGLLERCNCKERSEVTDTYKERLEYELEMLQQMGFSTYFLVVWDYIKYARDN
NIPVGPGRGSAAGSLVAYALGITNIDPVHHGLLFERFLNPERKSMPDIDTDFCIEKRDAM
IDYVTRKYGEDRVAQIITFNRMTSKAVLKDVARVLDIPYGEADRMAKLIPVARGKPTKLK
VMISDETPAPEFKEKYDKDPIVRRWLDMAIRIEGTNKTFGVHAAGVVIASEPLDQIVPLQ
RNNDGAVITQYFMEDLESLGLLKMDFLGLKNLTMIQKTTDLLKQNRQLDLDVDRVPMDDP
EAFQLLARGELEGVFQLESSGMRQVVKDLKPSNIEDISSILALYRPGPLDAGLIPKFINR
KHGRESIDYPHDLIKPILEETYGIMVYQEQIMKIAQDMAGYSLGQADLLRRAMGKKKMAE
MEKHREIFIDGAAEKGVDKKVSENLFDQMLLFAEYCLSYDTPVLTLEYGWLPIGQVVQEQ
IECQVFSINERGHLYTQPIAQWHHRGQQEVFEYTLADGSTIQATAEHQFMTTDGQMYPVQ
QIFEEGLSLKQLPLPWQSGLQLAS
Download sequence
Identical sequences B0C5E4
gi|158335662|ref|YP_001516834.1| 329726.AM1_2512 WP_012162980.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]