SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 329726.AM1_2834 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  329726.AM1_2834
Domain Number - Region: 73-100
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00153
Family Rubredoxin 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 329726.AM1_2834
Sequence length 126
Comment (Acaryochloris marina MBIC11017)
Sequence
MHETDMTKALIMTVKDWYDSQPEDPQITKIHLVVGRFTCVEPVSLQFAYEVQTRDTFLAG
TELVIRETPLIAFCHPCQQEYSPEMGLQYACPTCGAPMEDIRSGRELKIDHIEYCSDSAQ
TYAPNC
Download sequence
Identical sequences B0CA99
329726.AM1_2834 WP_012163278.1.67183 gi|158335976|ref|YP_001517150.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]