SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 329726.AM1_4357 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  329726.AM1_4357
Domain Number 1 Region: 30-223
Classification Level Classification E-value
Superfamily Formyltransferase 3.66e-61
Family Formyltransferase 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 329726.AM1_4357
Sequence length 223
Comment (Acaryochloris marina MBIC11017)
Sequence
MSFSASESVSPALVSPDEISLEKLSSSPPLKLGIMASGTGSNFVAIADAIAQHHLAAHIQ
VVIYNNPDAPVAQRAQERQIPTHLINHRHFSTREVFDQQIVDRLREADVDWVVMVGWMRR
VTQVLIDAFPDRMINIHPSLLPSFPGIRAIEQALEHQVKISGCTVHIVRLEVDSGPILIQ
AAVPVYPEDTPASLHRRIQIQEHRIIVQAIAQLIQNRLTPCRQ
Download sequence
Identical sequences B0CET9
329726.AM1_4357 gi|158337478|ref|YP_001518653.1| WP_012164662.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]