SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 330779.Saci_1107 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  330779.Saci_1107
Domain Number 1 Region: 3-85
Classification Level Classification E-value
Superfamily Homeodomain-like 3.97e-17
Family Tetracyclin repressor-like, N-terminal domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 330779.Saci_1107
Sequence length 196
Comment (Sulfolobus acidocaldarius DSM 639)
Sequence
MMYRAPKTEKGKESLNKILDASVELIADKGFLSTSINDITSKAGVAYGLFYFYFKSKHDI
LDEIIRQFNRNMRYYLKTYTQNLDSRIDVEKVGMKKFLEWMNENKKYYKIFIETQVHRPD
IYKWHFMKLAERYTTGLSEAMRRGEIINVDPELLSYVLIGIAHMLGKRYVLWSNSGLTLK
QQRDLDLIIENMLTPR
Download sequence
Identical sequences Q4J9S1
6el2_A 6el2_B 330779.Saci_1107 gi|70606882|ref|YP_255752.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]