SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 33178.CADATEAP00007478 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  33178.CADATEAP00007478
Domain Number 1 Region: 47-87
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000901
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 85-129
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000397
Family Zn2/Cys6 DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 33178.CADATEAP00007478
Sequence length 1028
Comment (Aspergillus terreus)
Sequence
MSLEKSDAGPERSIEAVNFPDVDGTIKTDSPGEDRGMQPSASSGQTTCSVCRSTFRRPEH
LKRHFRSHTKEKPFECTQCGRHFSRTITVKTFRACFKCAVARVRCSGGFPCARCENRSLE
CQYPTERRSKAKGRKDASQVLLSSKNGAPNDQPSRQNLSQQTLSPLAPDSDGAAQPPSQT
PAYEIGQFQVQLPSSNGPNPSVHRASGPGSHAYSETLENGHQGMRRDTNPDAPSETTTPP
FHPYGGANVLQPYPRVSTSNMRGTLAAERDSELNFQLRRPLEPANTEPEIDPAETSMQQS
QLAFTQPFLDHSTLSTINWLPNDFLLGSVNDTSTSPGFSSHTFRAGPSSSSLGPGSLFSP
TFNHSLSEDIAQIQRGYTNRPGTTGVSSRSTDQPLPSRLESNLNNKRSADNVHNSGAQIS
KYQRKPGPSGSRHRGSTSPLPHIQKDDAEPQFLFPMIEEPTVDAQFENGTASSFKIEPQT
YDHIYQWFRRLCCADDSLYRKFESATFPTARNLSTFVTMFFSSFQPIYPIFHRPTFNPNA
CHWLVTVAVSAIGCQYAGLNEQHKYAQAFHEFLRRAINVEKEKHRFDRSPLWLLQATILN
CLGLFHGRSERCGASAFSSFGDLVNHTMREGLLGPSGLAGLRPETLDQQWALWIEDEVRR
RLGYLIWLLDCTLAYHFDSRPLLCLDDGQAPLPSHERLWQANSALTWKRLLDDIPVTTAK
ETPSLYDATLMMYIEKNLVPWAGEFSQVLIIHALYHRMWEVGDYFRRPLSFWNPTAKKQS
RESAIPSGSVWLPGIPSYSKWRNSACDCLDILHWSANSAITEAAGLEHPPVLHLHEARLI
LLTPFREIRTLATALATDRVHWVDRQETLEWQYVLRWMKHDQYKARLAVIHSGNTLWHVR
RYLANTFHEPVAVFLATLTLWIYGLCHAEVFPDQSAAGQEPNTTVTIQLDTPCDDQLVQM
FVRKGHRMIGKVTGVGDVCGPYGPEMILKMGCETLAKLSSWGISRRLAAILTQLVEVTAE
TANGLPAM
Download sequence
Identical sequences Q0CW64
XP_001211248.1.65242 ATET_02070 33178.CADATEAP00007478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]