SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 332648.A6RXJ3 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  332648.A6RXJ3
Domain Number 1 Region: 49-98
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000109
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 111-155
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000611
Family Zn2/Cys6 DNA-binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 332648.A6RXJ3
Sequence length 466
Comment (Botryotinia fuckeliana B05.10)
Sequence
MSNHETFDSGSDALSILIDAASSIRADRQTHPEFARSSPPIPPATAVNQCRICQRTYERG
DHLTRHMRSHENSRPFQCQRCTKSFNRVDLLNRHVATHERNLGQNRPEIRRTERAGKACI
ACAAAKAKCEEQKPCLRCRTKDLVCEISQQSHKKRRISGIANEPRNSITERESLPRDSVT
QLSSIPDLILHSIDENEDYTTTSSCPDNSAENAEATLQPSYPLSALNTDKESSDFNFIQD
QLPFDSLANEMLFFPSTIFNNQISDFSFEDFDFQEENFEFPSLTSKRLTFDETTISGPSR
KVNDSRRDVARGHAAFARSPWLWTPASTDHILRDRDNLAIDEENISLNLSPNGARPYQHL
SITSSLRDKMFHLVSTTNRYANGIPSFPSLDLLNYIIEAFFCQQSNQVGNWIHTPTICLK
DVRPELLIAIVAVGSTSISLPAIWRMGLALQDVVRLSVSELVISSF
Download sequence
Identical sequences 332648.A6RXJ3 BC1T_05017 XP_001556399.1.26476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]