SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 335541.Swol_1329 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  335541.Swol_1329
Domain Number 1 Region: 153-339
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.18e-67
Family Methylesterase CheB, C-terminal domain 0.00000214
Further Details:      
 
Domain Number 2 Region: 5-106
Classification Level Classification E-value
Superfamily CheY-like 2.85e-25
Family CheY-related 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 335541.Swol_1329
Sequence length 341
Comment (Syntrophomonas wolfei Goettingen)
Sequence
MRLRRIKTLIVDDSLLFRETLARGISRDPAIEVVATAVDAFMARDMIIKYKPDVMTLDVE
MPRMSGIEFLRRLMPQYPLPVVMISALSESVFDALNAGAIDFVAKPDMNRNRDLDSFFSE
LILKIKIASVARLGRRAEVSKLLPTGKSQADQGWVIAIGASTGGPEAIYQIVKNFNQDTP
GTVIVQHMPAGFTRMYAERLNDTCVVEVKEAQNNDQVKMGQVLIAPGEYQMRLKQKAGNY
MVECHPGEKVNGHCPAVDVLFDSVAQSAGARAVGIILTGMGSDGARGLLAMRKAGARTIG
QDEASCVVYGMPKVAYELGAVEKQYPLNYIGQALYKLINQL
Download sequence
Identical sequences Q0AXB7
gi|114566854|ref|YP_754008.1| WP_011640737.1.6463 335541.Swol_1329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]