SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 338187.VIBHAR_02093 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  338187.VIBHAR_02093
Domain Number 1 Region: 196-394
Classification Level Classification E-value
Superfamily PheT/TilS domain 5.23e-78
Family B3/B4 domain of PheRS, PheT 0.000009
Further Details:      
 
Domain Number 2 Region: 38-196
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.37e-47
Family Myf domain 0.0028
Further Details:      
 
Domain Number 3 Region: 472-700
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.12e-47
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00012
Further Details:      
 
Domain Number 4 Region: 708-805
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 2.62e-30
Family Anticodon-binding domain of PheRS 0.00081
Further Details:      
 
Domain Number 5 Region: 403-480
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 7.69e-18
Family Domains B1 and B5 of PheRS-beta, PheT 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 338187.VIBHAR_02093
Sequence length 806
Comment (Vibrio harveyi ATCC BAA-1116)
Sequence
MKFSESWLREWVNPAVSTDELTHQITMAGLEVDDVLPVAGSFTGVKVGKVVECGQHPDAD
KLRVTKVDVGAEELLDIVCGASNCRLGIKVAVATVGAVLPGDFKIKKAKLRGQPSHGMLC
SFSELGIDVESDGIMELAEDAVIGTDFREFLGLDDVTVDVDLTANRADCFSIRGLAREVG
VLNRADITEPSVEAVAASIEDKVSIEVKAPAACPRYLGRVVKNVNVQAETPLWMQEKLRR
CGIRSIDPVVDITNYVLLEQGQPMHAFDLAKIEGGIVVRMAEQGEKLTLLDGSEAELNAD
TLVVADQNKALAIAGIFGGEESGVTTETKDVLLECAFFAPDHIRGRARSYGLHTDSSMRF
ERGVDYALQVSAMERATQLLVEICGGEVAPVVAVESEADLPKPNKVALRRTKLDNLLGHH
IADADVVEILERLGLTVVTTALDNQERGWTATAPTWRFDIAIEQDLIEEVGRIYGYDNIP
NQNPAAALKMHDHVEANIPLKRVRNLLVDRGYQEAITYSFVEPEQQKLVVPGVEPLILPF
PISADMSAMRLGLIQGLLNTVVHNQKRQQPRVRLFEYGLRFIPCESAENGMRQEPMLAGV
IAGTRSEEHWDIETNTVDFFDLKGDLEAVLELTANESAYSFAALSAEDKAANPALHPGQS
AAIIVDGKQVGVIGTVHPELERKFALNGRTIVFEVEWSAINTKVIPEAVQLSKFPSNRRD
IAVVVDEAVASGDIVAACLEQGGKFLKDAKLFDVYVGKGVEEGKKSLAIALTLQSVERTL
EDADIAGAVDAIVANVSEKFGASLRD
Download sequence
Identical sequences A7MVJ7
gi|538262803|gb|AGU94004.1| WP_012127826.1.100291 WP_012127826.1.11576 338187.VIBHAR_02093 gi|156974378|ref|YP_001445285.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]