SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 340100.Bpet0019 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  340100.Bpet0019
Domain Number 1 Region: 126-275
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 3.53e-34
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.0091
Further Details:      
 
Domain Number 2 Region: 63-111
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000627
Family AraC type transcriptional activator 0.01
Further Details:      
 
Domain Number 3 Region: 11-58
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000224
Family AraC type transcriptional activator 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 340100.Bpet0019
Sequence length 276
Comment (Bordetella petrii)
Sequence
MKATTRIHYANRLEPVLHWLASHPDAAPDLYHLADLACLSPYHFHRVYRALMGETVNATM
QRMRMHRASVDLAGSRPMPQVARRAGYTSQAAFNRAFGAAFGMPPGRYRHARSRPFNPQE
LGMYPVTIEQFAGASLATLAHQGDYQNIGATFDRLFMLAAGRDLVGPATRSFGVYYDDPA
QVPADRLRSRAGLTLPDGASADPVFEPFALPAARCAVLEYTGPYSEIEAAYNWLFAQWLP
ASGHETLDFPMWEEYVNDPKTTPAAELKTRIYLPLA
Download sequence
Identical sequences A9HVI2
WP_012247048.1.34756 gi|163854323|ref|YP_001628621.1| 340100.Bpet0019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]