SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 340102.Pars_0549 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  340102.Pars_0549
Domain Number 1 Region: 11-181
Classification Level Classification E-value
Superfamily Globin-like 0.00000000000000121
Family Globins 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 340102.Pars_0549
Sequence length 191
Comment (Pyrobaculum arsenaticum DSM 13514)
Sequence
MAVPGYDFGKVPDAPISDADFESLKKTVMWGEEDEKYRKMACEALKGQVEDILDLWYGWV
GSNQHLIYYFGDKSGRPIPQYLEAVRKRFGLWIIDTLCKPLDRQWLNYMYEIGLRHHRTK
KGKTDGVDTVEHIPLRYMIAFIAPIGLTIKPILEKSGHPPEAVERMWAAWVKLVVLQVAI
WSYPYAKTGEW
Download sequence
Identical sequences A4WIC7
gi|145590794|ref|YP_001152796.1| 340102.Pars_0549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]