SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 340102.Pars_1482 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  340102.Pars_1482
Domain Number 1 Region: 7-453
Classification Level Classification E-value
Superfamily L-aspartase-like 2.83e-138
Family HAL/PAL-like 0.000000766
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 340102.Pars_1482
Sequence length 467
Comment (Pyrobaculum arsenaticum DSM 13514)
Sequence
MEPVELGEKLTLIDVVKVATFGAPVVIPGDTRRKIEQAHSAYLEALQKGVEIYGVTTGLG
ELVKVKTVAQGSRIIVEHAVGVGDRSPREWVRAALLIRAHQLALGYSGVKPAVVEMLAEL
LNRDITPVVPIYGSVGASGDLAPLSHIALALLGEGHVKYKGEIVPAEEALRKEGLEPLLL
DPRDALALINGTSFSTAVLAMAIAKVENLLDKYLAYLPLYLHAVRANYKALLPETQVKRH
YGMKKIAEAIQYATPGKRLHDPYSVRCIPQVLGPLYDVLKWAREVVENEINSPSDNPIFT
DRGPVPTCHFHGQYIAMAADSLATALAIWANLLERQIAQLLRSDITGKPEFLAKEPGSVG
DMIYHYTAASLVAKIRTLATPYSVQNIPTSGFQEDVNSMSLGAAIRIHEIIKLLIDILSI
HSVVTHDATDCIDCQLHIEKIYSTISDLVKKSTIPSERIKAVSAIWS
Download sequence
Identical sequences A4WKX2
340102.Pars_1482 gi|145591689|ref|YP_001153691.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]