SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 340322.cgR_2392 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  340322.cgR_2392
Domain Number 1 Region: 28-332
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.26e-106
Family Glutaminase 0.00000271
Further Details:      
 
Domain Number 2 Region: 345-422
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000153
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 340322.cgR_2392
Sequence length 438
Comment (Corynebacterium glutamicum R)
Sequence
MSRCEPQNLSCTRVYSAKEITSLDSMLTMPIPEYLHEILDDVRDTTSGELADYIPELKSA
DPNPLAVALCTVNGHIYSAGDDDVAFTMQSISKPFAYALALQECGFDEVSASVALEPSGE
AFNELSLDGENRPMNPMINAGAIAINQLINGSDSTVEDRVEKIRQYFSELAGRELTIDRV
LAESELAGADRNLSIAHMLRNYGVIEDEAHDAVLSYTLQCAIKVTTRDLAVMTATLAAGG
THPITGKKLLDARVCRLTLSVMASAGMYDEAGQWLSTVGIPAKSGVAGGLIGILPGQLGI
ATFSPRLNPKGNSVRGVEIFKQLSDDMGLHLMSTEQVSGHAVRSITRDGDTTFIQMQGAM
NFSASESFLHAIVEHNFEGTEVVLDLTRVLSFHPVAIRMIKEGLKRIRDAGFEVFILDPD
GVLPDFMFSDGTICKERV
Download sequence
Identical sequences A4QGN3
340322.cgR_2392 gi|145296480|ref|YP_001139301.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]