SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 342108.amb0579 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  342108.amb0579
Domain Number 1 Region: 33-131
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.45e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 342108.amb0579
Sequence length 132
Comment (Magnetospirillum magneticum AMB-1)
Sequence
MDQIQFASFRPWSHKKSRSILTRWATEEFEYHMNISISHQDDTLTVRLDGTMDYTVTSQM
NSLISDIGSIKAARVVVDLTKVARVDSVGLGMLHLAKDEIVSNGRHLTLRGASGNVRRLF
ELTDGDSSFHFE
Download sequence
Identical sequences Q2W9U2
WP_011383022.1.61852 342108.amb0579 gi|83309678|ref|YP_419942.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]