SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 343509.SG1443 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  343509.SG1443
Domain Number 1 Region: 5-140
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.42e-33
Family MarR-like transcriptional regulators 0.0000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 343509.SG1443
Sequence length 144
Comment (Sodalis glossinidius morsitans)
Sequence
MESPLGSDLARLVRVWRALIDHRLKPLELTQTHWITLHNICQLPPEQSQIQLAKAIGIEQ
PSLVRTLDQLEEKGLITRHTCANDRRAKRIKLTESAEPIIKEVNNVIDSTRNEILNGISQ
EEIQLLSNMIAKLEKNILELYNKS
Download sequence
Identical sequences A0A193QK01 Q2NT07
343509.SG1443 gi|85059421|ref|YP_455123.1| WP_011411263.1.28452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]