SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 348780.NP2366A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP2366A
Domain Number 1 Region: 31-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000117
Family PadR-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 348780.NP2366A
Sequence length 118
Comment (Natronomonas pharaonis)
Sequence
MGSETTAGEARTDTDALPNKKPADLSKFQLRILAVLADAGDAPKGVTVKRRLQEYYSSDV
NPGQLYPNLNELVETGFVAKGQKDKRTNAYEITNDGQQALTSEVKWLAARTAGVAEEA
Download sequence
Identical sequences A0A1U7EW28
348780.NP2366A WP_011322900.1.57290 gi|76801826|ref|YP_326834.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]