SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 348780.NP3068A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP3068A
Domain Number 1 Region: 14-69
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000539
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 348780.NP3068A
Sequence length 97
Comment (Natronomonas pharaonis)
Sequence
MIDRLARQLRKEERDLLVLEIILQQHPIGIERIAEEAGLDEHKTRHSMRMLEDDDLIEPT
PQGAVPTDGVEERIGRIHGGIDSLIDRMEELKQYGNQ
Download sequence
Identical sequences A0A1U7EWY6
348780.NP3068A gi|76802174|ref|YP_327182.1| WP_011323247.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]