SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 348780.NP3126A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP3126A
Domain Number 1 Region: 11-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000491
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 348780.NP3126A
Sequence length 86
Comment (Natronomonas pharaonis)
Sequence
MSDHDAAVEPLPPSAKLVYKTLEYEGPMSQSQLADASLLPQRTVRHALRKLDAAGVVEES
VCLMDARKSTYELREPESSDPDTVTA
Download sequence
Identical sequences A0A1U7EX23
WP_011323276.1.57290 348780.NP3126A gi|76802203|ref|YP_327211.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]