SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 348780.NP6088A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  348780.NP6088A
Domain Number 1 Region: 23-71
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000165
Family PF1790-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 348780.NP6088A
Sequence length 122
Comment (Natronomonas pharaonis)
Sequence
MPVDFETHEPGNPRVDLSEGTNARRLLEFLLKTPSVGYTPAELAEETGVPRGSVGPTLNR
LEAAGLVRHKEPYWAAAEDDRIAAATAAFIGVETVASTYSDDWYAQNDGWDEELPDLSDE
ET
Download sequence
Identical sequences Q3IM41
WP_011324426.1.57290 gi|76803405|ref|YP_327674.1|NC_007427 348780.NP6088A gi|76803405|ref|YP_327674.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]