SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 349521.HCH_02538 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349521.HCH_02538
Domain Number 1 Region: 120-279
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.01e-47
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00039
Further Details:      
 
Domain Number 2 Region: 409-551
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.22e-38
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.001
Further Details:      
 
Domain Number 3 Region: 1-125
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 6.69e-27
Family Duplicated SiR/NiR-like domains 1 and 3 0.01
Further Details:      
 
Domain Number 4 Region: 253-277,316-422
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.94e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 349521.HCH_02538
Sequence length 553
Comment (Hahella chejuensis KCTC 2396)
Sequence
MYRYDDYDRQIIKERVKQFQGQTDRFFAGELSNEEFLPLRLQNGLYVQRLAPMLRICIPY
GMLSSTQLRKLSEVTRKYDKGYAHFTTRQNLQLNWPSVEDSPKILAELADVEMHAVQTSG
NCIRNTTTDQFAGVTPEEIVDPRPYCEIIRQWSTFHPEFAFLPRKFKIAVNACPDSDRAA
IQVHDIGIQIVKNAAGEIGYKVLAGGGLGRTPMIGSVIREYLPELDLLTYLEAILRVYNR
YGRRDNKYKARIKILVKAMSPEVFAEKVEAEWERLKDSPTKLTLAEIERIKSFFTEPAYL
ALEEQPVALTERLAENKFFSNWHHRNVAQHRKPGYAIVTLTLKKLGVPPGNITDKQMDRL
AELADQYSFGEMRITHEQNVVLADVEQSKLFELWEAIKSLGFATPNLGTLTDIICCPGGD
YCSLANAKSIPVAEAIQERFDNLDYLYDLGDIDLNISGCMNACGHHHVGAIGVLGVDKKG
EEWYQVSLGGASGQDASLGQILGPSFAREQMADVIEKILDVYVSSRNDDELFIDTFRRIG
ITPFKERVYAKPN
Download sequence
Identical sequences Q2SJ35
gi|83645329|ref|YP_433764.1| WP_011396408.1.94453 349521.HCH_02538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]