SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 349521.HCH_05104 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  349521.HCH_05104
Domain Number 1 Region: 14-96
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000667
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 349521.HCH_05104
Sequence length 98
Comment (Hahella chejuensis KCTC 2396)
Sequence
MDVILSMPWPLQPEAEKSFLMRCRELAEQGEERVFIRCDQVSHPSTRVLTLLLNMARLAP
YGPTRWRVIDAGENVLEALRLTGLDHWFKNETDEEAVA
Download sequence
Identical sequences Q2SC39
WP_011398850.1.94453 349521.HCH_05104 gi|83647775|ref|YP_436210.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]