SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 350058.Mvan_1017 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  350058.Mvan_1017
Domain Number 1 Region: 135-413
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.03e-79
Family D-glucarate dehydratase-like 0.00000000506
Further Details:      
 
Domain Number 2 Region: 3-133
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.38e-34
Family Enolase N-terminal domain-like 0.0000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 350058.Mvan_1017
Sequence length 445
Comment (Mycobacterium vanbaalenii PYR-1)
Sequence
MRTPVITDVTVVPIAGHDSMLLNLSGAHGPFFTRNLVIVEDSEGNTGVGEVPGGEPIRRT
LQDARGIVTGRSIGDYHAVLNEMRRTFADRDAGGRGAQTFDLRVTVHAVTAIESALMDLL
GQHLEVPVAALLGDGQQRSRVQALGYLFFVGDRTRTDLAYRSPSDEEPGADDWFTVRHEE
AMTPDAVVRLAEAARARYGFADFKLKGGVLPAADEAKAVIALAERFPDSRITLDPNGGWL
LADAIRTCRELKDVLAYAEDPVGPEDGFSGREVMAEFKRATGLPTATNMIATDWREMGHA
IRSGAVDIPLADPHFWTMTGSVRVAQLCDAWGLTWGSHSNNHFDVSLAMFTHVAAAAPGD
ITAIDTHWIWQDGQAITTNPYPIVDGYLSVPDAPGLGVTLDEPAVQAAHALYQREGLGGR
DDAVAMQYLIPGWTFDGKRPALDRG
Download sequence
Identical sequences A1T3V5
WP_011778290.1.45031 350058.Mvan_1017 gi|120402032|ref|YP_951861.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]