SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 350058.Mvan_1430 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  350058.Mvan_1430
Domain Number 1 Region: 442-556
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000235
Family Anti-sigma factor antagonist SpoIIaa 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 350058.Mvan_1430
Sequence length 566
Comment (Mycobacterium vanbaalenii PYR-1)
Sequence
MLTRWAPGLAGLREGRGAPLRVDLLAGLSVSAYLIPQALAYAALAGLSPIVGLWAALPPL
LIYAILGSSRQLSVGPESTTSLMTAAVLVPLVGGNDPVRYATYAAILAILVGVLCLAAGI
IGLGYLANLLSKPVLVGYLFGIAIAMVTGQLERISGVPVSGESVVEQVRAFASGIGQVHW
PTLMMAAAVLLCVVAVERAAPRLPGPLIAVLGAAAVVAVWSLTRYGIDVVGAIPAGAPSP
AVPVLADVPVRELLMAAVGIAVVAFSDNILTARAFAARVGETVDANAELRALGVSNIAVG
FLRGFPVSSSGSRTALAAAAGARTQRYSLVVLVVVSVVVLFGGSVVSTIPAAALGGLIVY
AAAKLVDVAGFKALARFRRSELVLALLTTFAVAVFGVLYGVLVAIGLTVLDLLRRLSHAH
DSVLGLVPGVAGMHDVDDYPDAALIPGLLVYRYDAPLCFANAEDFRRRALEAVDHMDQAS
PPVRWFLLNAEANVEVDMTAIEALDQLREECGRRGIVFAMARVKQDLRDALTAAGVIDKI
GEDRLYMTLPTAVEAYRAWAASRGTD
Download sequence
Identical sequences A1T514
350058.Mvan_1430 WP_011778693.1.45031 gi|120402441|ref|YP_952270.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]