SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 351160.RCIX2213 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  351160.RCIX2213
Domain Number 1 Region: 121-251
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 3.03e-26
Family MJ1460-like 0.036
Further Details:      
 
Domain Number 2 Region: 22-88
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000161
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 351160.RCIX2213
Sequence length 253
Comment (uncultured methanogenic archaeon RC-I)
Sequence
MKNGNVQDQVPIELFATDSGIRAIDSPVLVKILAMLKEREMPFDEIVANSGKAKSTISVH
LNRMIEAGVIGSRLDPDDRRKKIFFINSSYLGGLQKEAGIDDDIRDYFTRAKGGLPDMFA
FYRLMFRAIRVELYRQGVNIEPILTDAGYKIGQALYESVRSDDLGEMLGNIARFWSDHQL
GRMVVASMDPLTIYVYDCFECADLPQLGRPACAFDIGILKAIFIARFGKDPGIKEIGCYA
MGDGRCTFVIGGQ
Download sequence
Identical sequences Q0W2R1
gi|147919602|ref|YP_686658.1| 351160.RCIX2213 WP_012035249.1.28485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]