SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 351605.Gura_4160 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  351605.Gura_4160
Domain Number 1 Region: 106-251
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.56e-39
Family Potassium channel NAD-binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 7-124
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.06e-22
Family Voltage-gated potassium channels 0.0019
Further Details:      
 
Domain Number 3 Region: 236-330
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 7.32e-17
Family TrkA C-terminal domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 351605.Gura_4160
Sequence length 351
Comment (Geobacter uraniumreducens Rf4)
Sequence
MDPVRHLKISIFVLGLLVSLGTVGYMGIEGWRFLDALYMTVITLGTVGFREVHELSDSGK
LFTMLLIVFGVSVLGYIVGSLAQIMFEGQFQRIIGRKKVEKKIEALKDHYIICGFGRIGA
LICKEFAAKPIPFVVVEKDPQVVERLEQDSYLFLRGNATDDETLLKAGIKNAKGLISVVT
SDTENVYITLTARGLNPDLYILARSGEEGSEIKLKRAGANKVVSPYVIGGTRMAQAILRP
NVVDFIEIATGREFLELQMEEILIPPQSAFVGENLASSGFRKETGVIIIGIKKTSGKMVF
NPESHSHLEARDTLIVLGEPGAIQKLEELVNCEKCADAVINKHRKEPHHHA
Download sequence
Identical sequences A5G935
351605.Gura_4160 WP_011940934.1.63777 gi|148266170|ref|YP_001232876.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]